hsd_id_Homo_sapiens_652 [Download]
Identity: NP_005800.3
Length:198PF Description:C-terminal domain of 1-Cys peroxiredoxin, AhpC/TSA familyIPR Description:Peroxiredoxin, C-terminal, Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant
Identity: NP_001189360.1
Length:199PF Description:AhpC/TSA family, C-terminal domain of 1-Cys peroxiredoxinIPR Description:Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant, Peroxiredoxin, C-terminal
Identity: NP_006397.1
Length:271PF Description:C-terminal domain of 1-Cys peroxiredoxin, AhpC/TSA familyIPR Description:Peroxiredoxin, C-terminal, Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant
Identity: NP_006784.1
Length:256PF Description:AhpC/TSA family, C-terminal domain of 1-Cys peroxiredoxinIPR Description:Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant, Peroxiredoxin, C-terminal
>NP_005800.3
MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN
>NP_001189360.1
MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK
>NP_006397.1
MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN
>NP_006784.1
MAAAVGRLLRASVARHVSAIPWGISATAALRPAACGRTSLTNLLCSGSSQAKLFSTSSSCHAPAVTQHAPYFKGTAVVNGEFKDLSLDDFKGKYLVLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGSGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQYVETHGEVCPANWTPDSPTIKPSPAASKEYFQKVNQ