hsd_id_Bos_taurus_100 [Download]
Identity: NP_776857.1
Length:257PF Description:C-terminal domain of 1-Cys peroxiredoxin, AhpC/TSA familyIPR Description:Peroxiredoxin, C-terminal, Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant
Identity: NP_777188.1
Length:199PF Description:AhpC/TSA family, C-terminal domain of 1-Cys peroxiredoxinIPR Description:Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant, Peroxiredoxin, C-terminal
Identity: NP_776858.1
Length:274PF Description:AhpC/TSA family, C-terminal domain of 1-Cys peroxiredoxinIPR Description:Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant, Peroxiredoxin, C-terminal
Identity: XP_024840451.1
Length:199PF Description:AhpC/TSA family, C-terminal domain of 1-Cys peroxiredoxinIPR Description:Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant, Peroxiredoxin, C-terminal
>NP_776857.1
MAATAGRLFRASLIRHVSAIPWGISASAALRPAASRRMCLTNALWSGSDQAKFAFSTSSSYHAPAVTQHAPYFKGTAVVSGEFKEISLDDFKGKYLVLFFYPLDFTFVCPTEIIAFSDKASEFHDVNCEVVAVSVDSHFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGPGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETLRLVKAFQFVEAHGEVCPANWTPESPTIKPHPTASREYFEKVNQ
>NP_777188.1
MACVCKAHVGKPAPEFQATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIVAFSDRAAEFHKLNCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRKLSSDYGVLKEDEGIAYRGLFVIDGKGVLRQVTINDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWTPGSDTIKPNVDDSKEYFSKHN
>NP_776858.1
MEAPPPPPPLPATTLAPGRSRKLLLLPLLLFLLRAEAVRGFEAEERPRTREEECHFYAGGQVYPGEVSRVSVAEHSLHLSKAKISKPAPYWEGTAVINGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRIDEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGSINIPLLADLNHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN
>XP_024840451.1
MSSGNAKIGHRAPQFKATAVMPDGQFKDISLADYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLISDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK