hsd_id_Loxodonta_africana_454	XP_003409146.1; XP_010594045.1; XP_003415616.1	256; 270; 199	Pfam	PF10417, PF00578; PF00578, PF10417; PF10417, PF00578	C-terminal domain of 1-Cys peroxiredoxin, AhpC/TSA family; AhpC/TSA family, C-terminal domain of 1-Cys peroxiredoxin; C-terminal domain of 1-Cys peroxiredoxin, AhpC/TSA family	IPR019479, IPR000866; IPR000866, IPR019479; IPR019479, IPR000866	Peroxiredoxin, C-terminal, Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant; Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant, Peroxiredoxin, C-terminal; Peroxiredoxin, C-terminal, Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant

>XP_003409146.1
MAATAGRLIRALVARQVSAIPWGVSASAALRPAASGRKCLTNTLWSGSHQAKCSFSTGSSYLAPAVTQHAPYFKGTAVVNGEFKDLSLDDFKGKYLVLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCDVVAVSVDSHFSHLAWINTPRKNGGLGHMNIPLLSDLTKQISRDYGVLLENPGLALRGLFIIDPNGIIKHLSVNDLPVGRSVEETLRLVKAFQFVETHGEVCPANWTPDSPTIKPSPTASKEYFEKVH
>XP_010594045.1
MEAPPPKXASTATPGRSRRLLLPLLLLLLPTGVVWGWEAEERPRTREEECHFYAGGQVYPGESSRVSVTDHSLHLSKAKISKPAPYWEGTAVINGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRIEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLNHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN
>XP_003415616.1
MSSGAAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYIVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK