hsd_id_Drosophila_melanogaster_86	NP_477510.1; NP_648759.1; NP_525002.1; NP_524387.1	194; 196; 242; 234	Pfam	PF00578, PF10417; PF10417, PF00578; PF10417, PF00578; PF10417, PF00578	AhpC/TSA family, C-terminal domain of 1-Cys peroxiredoxin; C-terminal domain of 1-Cys peroxiredoxin, AhpC/TSA family; C-terminal domain of 1-Cys peroxiredoxin, AhpC/TSA family; C-terminal domain of 1-Cys peroxiredoxin, AhpC/TSA family	IPR000866, IPR019479; IPR019479, IPR000866; IPR019479, IPR000866; IPR019479, IPR000866	Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant, Peroxiredoxin, C-terminal; Peroxiredoxin, C-terminal, Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant; Peroxiredoxin, C-terminal, Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant; Peroxiredoxin, C-terminal, Alkyl hydroperoxide reductase subunit C/ Thiol specific antioxidant

>NP_477510.1
MPQLQKPAPAFAGTAVVNGVFKDIKLSDYKGKYLVLFFYPLDFTFVCPTEIIAFSESAAEFRKINCEVIGCSTDSQFTHLAWINTPRKQGGLGSMDIPLLADKSMKVARDYGVLDEETGIPFRGLFIIDDKQNLRQITVNDLPVGRSVEETLRLVQAFQYTDKYGEVCPANWKPGQKTMVADPTKSKEYFETTS
>NP_648759.1
MRMLNINQVAPNFTTNAVVSGGYRNFALTDLRGRYVLLVFYPADFSYVCPTELQAFSDRAPEFRNVGCEVLACSTDSHFVHCAWMNTPRKNGGLGELDIPLLADKNMKIARDYGVLDEDTGLALRALFIIDREGRIRQITVNDMGVGRSVDEALRLVQAFQFSDEFGEVCPVNWRPGAKTMKADATGKEEYFKHAI
>NP_525002.1
MSKYLSVLLLSAALVGAAKPEDNESCYSFAGGSVYPDQPKGDHQLQYTKAVISKPAPQFEGTAVVNKEIVKLSLSQYLGKYVVLLFYPLDFTFVCPTEIIAFSDRIAEFKKIKTEVIGVSVDSHFTHLAWINTPRKEGGLGDVKIPLLSDLTHKISKDYGVYLESSGHALRGLFIIDQTGVLRQITMNDLPVGRSVDETIRLVQAFQYTDTHGEVCPAGWRPGADTIVPNPEEKTKYFAKNN
>NP_524387.1
MSFVARSLIRNVPLMGKAILSQQKQIAARLLHQTAPLAAVRVQQPAPDFKGLAVVDNSFQEVKLEDYRGKYLVLFFYPLDFTFVCPTEIVAFSERIKEFHDINTEVLGVSVDSHFSHLTWCNVDRKNGGVGQLKYPLLSDLTKKISADYDVLLDKEGISLRGTFIIDPNGILRQYSINDLPVGRSVDEVLRLIKAFQFVEQHGEVCPANWNPNSNPATIKPDVEESKKYFSKHG